PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_03637_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LFY
Protein Properties Length: 406aa    MW: 45106.8 Da    PI: 7.0511
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_03637_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY638.31.1e-19413871385
                     FLO_LFY   1 mdpeafsas.lfkwdpraaaaapparlleeaavseapleaaaaaaarklr......eleelfkayGvryltvakiaelGftvs 76 
                                 mdpe+f++  +fkwdpr ++a++parl+e  a++++p+++a+aaaa  +       ++eelf+ayG+ry+t+akiaelGftv+
  Cotton_A_03637_BGI-A2_v1.0   1 MDPETFASGsFFKWDPRGMMAPTPARLMEAVAAVPQPQTVAVAAAAAYMGrprelgGIEELFQAYGIRYYTAAKIAELGFTVN 83 
                                 9****977559***********9*****99999999966665555544334777889************************** PP

                     FLO_LFY  77 tLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkll......sedeetaldalsqeglseep 153
                                 tL++mk+eeld++m+s+s+ifr++llvGeryGikaavraerrrleee+  ++rr+l+      ++  ++aldalsqeglseep
  Cotton_A_03637_BGI-A2_v1.0  84 TLLGMKEEELDEMMNSVSQIFRWELLVGERYGIKAAVRAERRRLEEED--SRRRHLVlgdtttTTTAANALDALSQEGLSEEP 164
                                 **********************************************88..66666663554333333449************* PP

                     FLO_LFY 154 vqeekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededee.eeededeegsgedgeerqrehPfiv 235
                                 vq+ekeaagsgg+g  ++e+v         ++k++   ++++ +kk ++ ++ ++ e  ++d+++ ++g +g erqrehPfiv
  Cotton_A_03637_BGI-A2_v1.0 165 VQQEKEAAGSGGGG--TWEMVIGGG-----RRKQQ---RRRKGQKKVVEVDNGDEFEgGDDDDENGDGGGGGYERQREHPFIV 237
                                 **********9999..999999883.....23333...22222333333334444440444445555677788********** PP

                     FLO_LFY 236 tepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeea 318
                                 tepgevargkknGLDYLf+LyeqCr+fL+qvq+iak+rGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeea
  Cotton_A_03637_BGI-A2_v1.0 238 TEPGEVARGKKNGLDYLFHLYEQCRDFLIQVQNIAKDRGEKCPTKVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEEA 320
                                 *********************************************************************************** PP

                     FLO_LFY 319 snalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                                 snalrrafkergenvGawrqacykplv+iaarqgwdida+fnahprL+iWYvPtkLrqLCh+er+ a
  Cotton_A_03637_BGI-A2_v1.0 321 SNALRRAFKERGENVGAWRQACYKPLVSIAARQGWDIDAIFNAHPRLAIWYVPTKLRQLCHAERNGA 387
                                 ****************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.9E-2061387IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MDPETFASGS FFKWDPRGMM APTPARLMEA VAAVPQPQTV AVAAAAAYMG RPRELGGIEE  60
LFQAYGIRYY TAAKIAELGF TVNTLLGMKE EELDEMMNSV SQIFRWELLV GERYGIKAAV  120
RAERRRLEEE DSRRRHLVLG DTTTTTTAAN ALDALSQEGL SEEPVQQEKE AAGSGGGGTW  180
EMVIGGGRRK QQRRRKGQKK VVEVDNGDEF EGGDDDDENG DGGGGGYERQ REHPFIVTEP  240
GEVARGKKNG LDYLFHLYEQ CRDFLIQVQN IAKDRGEKCP TKVTNQVFRY AKKAGASYIN  300
KPKMRHYVHC YALHCLDEEA SNALRRAFKE RGENVGAWRQ ACYKPLVSIA ARQGWDIDAI  360
FNAHPRLAIW YVPTKLRQLC HAERNGAAVV AAASSSVSGG HDHMGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1122263992183PROTEIN LEAFY
2vy2_A1e-1122263992183PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN7951310.0JN795131.1 Gossypium hirsutum LFY mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467284.10.0PREDICTED: floricaula/leafy homolog isoform X1
SwissprotO040640.0FLLH_POPTR; Floricaula/leafy homolog
TrEMBLU5HU290.0U5HU29_G
STRINGPOPTR_0015s11820.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-154floral meristem identity control protein LEAFY (LFY)